PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc02012.1.g00090.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB_related
Protein Properties Length: 110aa    MW: 12279.9 Da    PI: 8.2216
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc02012.1.g00090.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.72.6e-181562148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  +g+WT+ Ed ll ++v+q+G g+W+t+a+  g++R++k+c++rw +yl
  Zpz_sc02012.1.g00090.1.am.mk 15 KGPWTALEDRLLTEYVQQHGEGSWNTVAKITGLRRSGKSCRLRWVNYL 62
                                  79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.977166IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-211265IPR009057Homeodomain-like
SMARTSM007171.4E-141464IPR001005SANT/Myb domain
PfamPF002498.9E-171562IPR001005SANT/Myb domain
SuperFamilySSF466893.13E-231690IPR009057Homeodomain-like
CDDcd001671.22E-111762No hitNo description
PROSITE profilePS500905.1226394IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.609.6E-96694IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 110 aa     Download sequence    Send to blast
MDSISSLMLQ GGWRKGPWTA LEDRLLTEYV QQHGEGSWNT VAKITGLRRS GKSCRLRWVN  60
YLRPDLKRGK ITPDEETIIL QLHAMLGNSL WRLVDGDSCS AGDGSSGGEY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-1515882799MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9604501e-98EU960450.1 Zea mays clone 224989 MYB305 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002465878.12e-55hypothetical protein SORBIDRAFT_01g047450
SwissprotQ9SSA12e-33MYB57_ARATH; Transcription factor MYB57
TrEMBLC5WYU82e-55C5WYU8_SORBI; Putative uncharacterized protein Sb01g047450
STRINGSb01g047450.17e-55(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132282433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.11e-41myb domain protein 305